PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_9.313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 201aa    MW: 22934.7 Da    PI: 9.4935
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_9.313genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63.1e-099591363
                                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                 NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  evm.model.supercontig_9.313  9 NRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 59
                                 **************************************9999888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-9161IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.71E-10452No hitNo description
CDDcd147039.12E-20451No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-8955No hitNo description
PfamPF001702.8E-7955IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.576962IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGMKVIWANR QSAARSKERK MRYIAELERK VQTLQTEATS LSAQLTLLQR DTNGLTAENS  60
ELKLRLQTME QQVHLQDALN DALKEEIQHL KVLTGQALPN GAPIMNFASY GAGQQFYANN  120
HAMHTLLTAQ QFQQLQIHSQ KQQQQQFQQH QLHQLQQQQL QQQEQQQQQQ QQSGDLRIKG  180
SMPSPNQKDN TSDVNPPTKD *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7712917e-80KC771291.1 Camellia sinensis bZIP transcription factor family protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478733.12e-95PREDICTED: probable transcription factor PosF21
RefseqXP_006442989.12e-95hypothetical protein CICLE_v10020263mg
SwissprotQ040886e-68POF21_ARATH; Probable transcription factor PosF21
TrEMBLV4VSX83e-95V4VSX8_9R
STRINGVIT_05s0102g01120.t016e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-66bZIP family protein